PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G038100.1.p
Common NameGLYMA_19G038100, LOC100796379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 337aa    MW: 37944.7 Da    PI: 7.1941
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G038100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-152269148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Glyma.19G038100.1.p 22 KGLWSPEEDEKLLRYMITKGQGCWSDIARNAGLQRCGKSCRLRWINYL 69
                         678*******************************************97 PP

2Myb_DNA-binding49.97.2e-1675119147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          rg+++++E+e +++++  lG++ W+ Ia++++ gRt++++k++w++ 
  Glyma.19G038100.1.p  75 RGAFSPQEEEVIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 119
                          89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1421769IPR017930Myb domain
SuperFamilySSF466893.63E-2820116IPR009057Homeodomain-like
SMARTSM007178.1E-132171IPR001005SANT/Myb domain
PfamPF002494.4E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-232376IPR009057Homeodomain-like
CDDcd001672.39E-112569No hitNo description
PROSITE profilePS5129425.6370124IPR017930Myb domain
SMARTSM007172.0E-1574122IPR001005SANT/Myb domain
PfamPF002493.0E-1475119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2677124IPR009057Homeodomain-like
CDDcd001674.29E-1177120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MRKPDMMGKD KINNNIKSKL RKGLWSPEED EKLLRYMITK GQGCWSDIAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSP QEEEVIIHLH SILGNRWSQI AARLPGRTDN EIKNFWNSTL  120
KKRLKMNNNN STLSPNNSDS SGPKDVNVMG GIMSMNEHDL MTMCMDSSSS TSSSSCMQSM  180
HATNMVLTNP FPLLPNNRYD MMTGATGFLD NMAAACLTQV GMVDHDHGVV HGTLEPNKTR  240
LGSDFSLPPL ESRSIEDNSS TPIDHVKSHN NNNHFKNSCF NNTDHYHHIQ SSNNVVVEDL  300
FGFGNHGQGE NFRMGEWDLE GLMQDISYFP SLDFQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27201245108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119125LKKRLKM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358810.0AC235881.2 Glycine max clone GM_WBc0011H22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555035.20.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0B2RG480.0A0A0B2RG48_GLYSO; Transcription factor MYB46
TrEMBLI1N6I20.0I1N6I2_SOYBN; Uncharacterized protein
STRINGGLYMA19G05080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-70myb domain protein 83